PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000311190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 814aa    MW: 92383.3 Da    PI: 6.6079
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000311190genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM122.53.7e-38191462128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    ++G+rFhPt eel+++yLk k++g +  ++++i+e++i+++ePw+Lp  ++ ++++ewyf+ +   k+++ ++ +rat++g+Wk+tgk+k v+ ++
  MDP0000311190  19 QVGYRFHPTKEELISHYLKLKLRGMDSLVSDAIREINICNYEPWELPeISLIKSDDEWYFYNRPIYKKNSRNEVERATATGFWKSTGKEKIVKXRD 114
                    78************************99999****************545556789**************************************** PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++ +g k++L+f +gr +++  t+Wvmhe+++
  MDP0000311190 115 NKIIGKKRILTFRQGRGRNAPITNWVMHEFSI 146
                    ******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-419166IPR003441NAC domain
PROSITE profilePS5100542.69618166IPR003441NAC domain
PfamPF023652.5E-1920146IPR003441NAC domain
SuperFamilySSF562191.42E-6508686IPR005135Endonuclease/exonuclease/phosphatase
PROSITE patternPS000180701713IPR018247EF-Hand 1, calcium-binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MASNGIRFTR VEVGGMLLQV GYRFHPTKEE LISHYLKLKL RGMDSLVSDA IREINICNYE  60
PWELPEISLI KSDDEWYFYN RPIYKKNSRN EVERATATGF WKSTGKEKIV KXRDNKIIGK  120
KRILTFRQGR GRNAPITNWV MHEFSIPQIX PNANQRXFVL CYVKKKSGKN TDVATGDEGE  180
SSNYNNAPDF ENQLQPARNM HVEEERTQPP PNPDIFQREL DLMLGNTRGN NDYHGMDENL  240
EEFVNGLFGD DPYQGYSEEI THNNVFNDST LPQSPRKVYL XDCGVSSDSD TEVQHQAAQG  300
PSLQMLGVPQ ASSSHFGREE GAMLRNQTLR QAASSINVLP KPQTDRLQSI SDEDSGTHQI  360
TSRLRRASRP INALKLKSAS SVDVDAVSLQ INSIQLASDE YYNSERTRRR TYPTSALLAL  420
GKPNELEQQQ SKAKVAAERR AAVDFPPKRN FITESNKDAE AGLGAGSNVX KINRRESESL  480
SRSYSGSCIS LPSIAELKPE TLAGPCLVSC MTFNILAPIY KRLDQQNQSL SESDYGXFWV  540
ARNHRILDWL LCESSAXICL QFWVGNEEFV NMYLDRLGDA GYTTFKLART NNRGDGLLXA  600
XRRDCFSVRN CQELHFNDFG DRVAQLLHVH DWNGSKRGHV YKFLRSQGFE STYDTAHQYT  660
NADAHKRQLR KASMAENDAF AFLKGDSHGF QETRDLWIQA DADANGVLDY EEFKNRIWSS  720
XASEDKESLN GSREESKRGM QDSLXFNVKN AVLYPREXEK GIWPEDYTLS DHARLSVVLS  780
PERMWCFIDL YGFVSLLVAL QLQALSGGLT IISN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-2151462140Stress-induced transcription factor NAC1
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.244491e-160fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376275.10.0PREDICTED: NAC domain-containing protein 19-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13478522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.27e-34TCV-interacting protein